PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240265.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 350aa    MW: 39319.6 Da    PI: 7.0738
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240265.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85.1e-5451311129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+ kv++ +++  ++++ vd++k+ePwdLp k++ +ekewyfF  rd+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_008240265.2   5 LPPGFRFHPTDEELITYYLCCKVSDVSFTS-KAVAVVDLNKCEPWDLPGKASMGEKEWYFFNLRDRKYPTGLRTNRATEAGYWKTTGKDKEIHR- 97 
                     79*************************999.88***************988999***************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      g lvg+kktLvfykgrap+gek++Wvmheyrle
  XP_008240265.2  98 AGVLVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-623151IPR003441NAC domain
PROSITE profilePS5100558.6845151IPR003441NAC domain
PfamPF023657.7E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MQDSLPPGFR FHPTDEELIT YYLCCKVSDV SFTSKAVAVV DLNKCEPWDL PGKASMGEKE  60
WYFFNLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIHRAGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFKSSK EEWVVCRVFQ KSTSLKKPQQ TTTSSQQQQQ TSIESPCDET  180
NSIVNEFGDI ELPNLNSNNI ANSSSGLIST MPSSQSCYNN NINDHSSDVN MSLNMNWRCS  240
ANGSPDANVA XWPSNLLTPS NLSVNSLLLR ALQLRSSNTG AATLDPSYSY NNNNIINMEQ  300
GMPRPMSQFG SGTSADMNSN FQASSSTRDM MEAVPPQQHP EQPFNLDSIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-58215714171NO APICAL MERISTEM PROTEIN
1ut4_B7e-58215714171NO APICAL MERISTEM PROTEIN
1ut7_A7e-58215714171NO APICAL MERISTEM PROTEIN
1ut7_B7e-58215714171NO APICAL MERISTEM PROTEIN
4dul_A7e-58215714171NAC domain-containing protein 19
4dul_B7e-58215714171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240265.10.0PREDICTED: LOW QUALITY PROTEIN: protein CUP-SHAPED COTYLEDON 1
TrEMBLM5WUQ10.0M5WUQ1_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-148(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-100NAC domain containing protein 58